{"product_id":"proteintech-29790-1-ap","title":"Proteintech, 29790-1-AP, Trypsin 1\/PRSS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Trypsin 1\/PRSS1 (29790-1-AP) by Proteintech is a Polyclonal antibody targeting Trypsin 1\/PRSS1 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29790-1-AP targets Trypsin 1\/PRSS1 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRSS1 encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is secreted by the pancreas and cleaved to its active form in the small intestine. It is active on peptide linkages involving the carboxyl group of lysine or arginine. Mutations in this gene are associated with hereditary pancreatitis. This gene and several other trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31383 Product name: Recombinant human PRSS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-140 aa of BC128226 Sequence: IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCL Predict reactive species\nFull Name: protease, serine, 1 (trypsin 1)\nCalculated Molecular Weight: 27 kDa\nGenBank Accession Number: BC128226\nGene Symbol: PRSS1\nGene ID (NCBI): 5644\nRRID: AB_3669696\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07477\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887775240361,"sku":"29790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29790-1-ap","provider":"Iright","version":"1.0","type":"link"}