{"product_id":"proteintech-29793-1-ap","title":"Proteintech, 29793-1-AP, WNT5A\/B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WNT5A\/B (29793-1-AP) by Proteintech is a Polyclonal antibody targeting WNT5A\/B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n29793-1-AP targets WNT5A\/B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, HeLa cells,  MCF-7 cells,  SKOV-3 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. There are 19 Wnt genes in the human genome that encode functionally distinct Wnt proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt members bind to the Frizzled family of seven-pass transmembrane proteins and activate several signaling pathway. Wnt5A is a member of the Wnt family of proteins, which are 38-45 kDa secreted cysteine-rich proteins with hydrophobic signal peptides.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31507 Product name: Recombinant human WNT5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-380 aa of BC064694 Sequence: EGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK Predict reactive species\nFull Name: wingless-type MMTV integration site family, member 5A\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC064694\nGene Symbol: WNT5A\nGene ID (NCBI): 7474\nRRID: AB_3086163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869390524585,"sku":"29793-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29793-1-ap","provider":"Iright","version":"1.0","type":"link"}