{"product_id":"proteintech-29802-1-ap","title":"Proteintech, 29802-1-AP, SLC27A6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC27A6 (29802-1-AP) by Proteintech is a Polyclonal antibody targeting SLC27A6 in WB, ELISA applications with reactivity to Human, mouse, rat samples\n29802-1-AP targets SLC27A6 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC27A6, also known as FATP6, ACSVL2, FACVL2, belongs to the ATP-dependent AMP-binding enzyme family. SLC27A6 mediates the import of long-chain fatty acids (LCFA) into the cell by facilitating their transport at the plasma membrane (PMID: 12556534). SLC27A6 plays a pivotal role in regulating available LCFA substrates from exogenous sources in tissues undergoing high levels of beta-oxidation. SLC27A6 is strongly expressed in heart and localizes to cardiac myocytes. SLC27A6 is expressed at moderate levels in placenta, testis, and adrenal glands(PMID: 12556534).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32179 Product name: Recombinant human SLC27A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 442-619 aa of BC041945 Sequence: KHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKSYVLLTRELYDQIMLGEIKL Predict reactive species\nFull Name: solute carrier family 27 (fatty acid transporter), member 6\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC041945\nGene Symbol: SLC27A6\nGene ID (NCBI): 28965\nRRID: AB_3086167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2P4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805583529,"sku":"29802-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29802-1-ap","provider":"Iright","version":"1.0","type":"link"}