{"product_id":"proteintech-29811-1-ap","title":"Proteintech, 29811-1-AP, MIGA2\/FAM73B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MIGA2\/FAM73B (29811-1-AP) by Proteintech is a Polyclonal antibody targeting MIGA2\/FAM73B in WB, ELISA applications with reactivity to human samples\n29811-1-AP targets MIGA2\/FAM73B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  U2O2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMIGA2 (mitoguardin-2) also named as FAM73B, is a mitochondrial protein at contacts with the ER and\/or lipid droplets (LDs), and identified as a lipid transporter. MIGA2 localizes to contact sites between mitochondria and the ER or mitochondria and lipid droplets (LDs) (PMID: 36282247). Based on its presence in many tissues, MIGA2 is likely critical for lipid and energy homeostasis in a wide spectrum of cell types (PMID: 31628041).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30577 Product name: Recombinant human FAM73B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 62-180 aa of BC009114 Sequence: AHQLKRRRRRKKQVGPEMGGEQLGTVPLPILLARKVPSVKKGYSSRRVQSPSSKSNDTLSGISSIEPSKHSGSSHSVASMMAVNSSSPTAACSGLWDARGMEESLTTSDGNAESLYMQG Predict reactive species\nFull Name: family with sequence similarity 73, member B\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC009114\nGene Symbol: MIGA2\/FAM73B\nGene ID (NCBI): 84895\nRRID: AB_3086170\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7L4E1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887719633065,"sku":"29811-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29811-1-ap","provider":"Iright","version":"1.0","type":"link"}