{"product_id":"proteintech-29832-1-ap","title":"Proteintech, 29832-1-AP, MUC13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MUC13 (29832-1-AP) by Proteintech is a Polyclonal antibody targeting MUC13 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples\n29832-1-AP targets MUC13 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HEK-293 cells,  HT-29 cells,  SW480 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human colon cancer tissue, human colon tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMucins (MUC) are highly glycosylated proteins that are abundantly expressed in mammalian epithelial cells. Mucin 13 (MUC13) is a member of the transmembrane glycoprotein mucins which is normally expressed in the large intestine, trachea, kidney, small intestine, and gastric epithelium (PMID: 22027689). MUC13 is involved in the tumorigenesis of multiple malignancies, including pancreatic cancer, colorectal cancer, renal cancer and lung cancer (PMID: 22027689; PMID: 31427737; PMID: 28205224; PMID: 34966453).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse, Rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31090 Product name: Recombinant human MUC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 208-421 aa of NM_033049 Sequence: STCKKGKVFPGKISVTVSETFDPEEKHSMAYQDLHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTIVTILAETTSDNEKTVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQL Predict reactive species\nFull Name: mucin 13, cell surface associated\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 70-120 kDa\nGenBank Accession Number: NM_033049\nGene Symbol: MUC13\nGene ID (NCBI): 56667\nRRID: AB_2923611\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3R2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887727235241,"sku":"29832-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29832-1-ap","provider":"Iright","version":"1.0","type":"link"}