{"product_id":"proteintech-29890-1-ap","title":"Proteintech, 29890-1-AP, SNIP\/p140Cap Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNIP\/p140Cap (29890-1-AP) by Proteintech is a Polyclonal antibody targeting SNIP\/p140Cap in WB, ELISA applications with reactivity to Human, mouse, rat samples\n29890-1-AP targets SNIP\/p140Cap in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSNIP, also named SRC kinase signaling inhibitor 1 (SRCIN1) and p140 Cas-associated protein (p140CAP), contains two regions of highly charged amino acids, two proline-rich regions, and two coiled-coil domains. SNIP plays a role in SRC inactivation and acts as a tumor suppressor gene in cancers. MiR-32 suppresses the expression of SNIP, thereby suppressing proliferation and epithelial-mesenchymal transition (EMT) of human liver cancer cells (PMID: 28550679).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31857 Product name: Recombinant human SNIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1011-1182 aa of Sequence: RSFPSSHGLTTTRTGEVVVTSKKDSAFIKKAESEELEVQKPQVKLRRAVSEVARPASTPPIMASAIKDEDDEDRIIAELESGGGSVPPMKVVTPGASRLKAAQGQAGSPDKSKHGKQRAEYMRIQAQQQATKPSKEMSGSNETSSPVSEKPSASRTSIPVLTSFGARNSSIS Predict reactive species\nFull Name: SNAP25-interacting protein\nCalculated Molecular Weight: 127 kDa\nObserved Molecular Weight: 145 kDa\nGene Symbol: SNIP\nGene ID (NCBI): 80725\nRRID: AB_3086180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C0H9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887810629801,"sku":"29890-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29890-1-ap","provider":"Iright","version":"1.0","type":"link"}