{"product_id":"proteintech-29898-1-ap","title":"Proteintech, 29898-1-AP, NFIB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFIB (29898-1-AP) by Proteintech is a Polyclonal antibody targeting NFIB in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n29898-1-AP targets NFIB in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, HeLa cells,  HepG2 cells,  NIH\/3T3 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFIB, also named as Nuclear factor 1, is a 420 amino acid protein, which belongs to the CTF\/NF-I family and may bind DNA as a homodimer. NFIB recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. NFIB also exists in multiple isoforms in prostate cancer cells, with average molecular weights of 62 kDa, 57 kDa, and 49 kDa (PMID: 32692871).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31946 Product name: Recombinant human NFIB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-340 aa of BC001283 Sequence: LAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFP Predict reactive species\nFull Name: nuclear factor I\/B\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 45-65 kDa\nGenBank Accession Number: BC001283\nGene Symbol: NFIB\nGene ID (NCBI): 4781\nRRID: AB_3086183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00712\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869718565033,"sku":"29898-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29898-1-ap","provider":"Iright","version":"1.0","type":"link"}