{"product_id":"proteintech-29907-1-ap","title":"Proteintech, 29907-1-AP, TRIM69 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM69 (29907-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM69 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n29907-1-AP targets TRIM69 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, SH-SY5Y cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nE3 ubiquitin-protein ligase TRIM69 (TRIM69) plays an important role in antiviral immunity by restricting different viral infections including dengue virus or vesicular stomatitis Indiana virus (PubMed:31375575, PubMed:31578292). It plays also a role in cataract formation together with TP53 (PubMed:30844644). Mechanistically, inhibits UVB-induced cell apoptosis and reactive oxygen species (ROS) production by inducing TP53 ubiquitination (PubMed:30844644). It has 4 isoforms with molecular weights of 57, 39, 34, and 32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31775 Product name: Recombinant human TRIM69 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC033314 Sequence: MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGD Predict reactive species\nFull Name: tripartite motif-containing 69\nCalculated Molecular Weight: 500 aa, 57 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC033314\nGene Symbol: TRIM69\nGene ID (NCBI): 140691\nRRID: AB_2935487\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86WT6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887839006889,"sku":"29907-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29907-1-ap","provider":"Iright","version":"1.0","type":"link"}