{"product_id":"proteintech-29910-1-ap","title":"Proteintech, 29910-1-AP, RORC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RORC (29910-1-AP) by Proteintech is a Polyclonal antibody targeting RORC in WB, ELISA applications with reactivity to human, mouse, rat samples\n29910-1-AP targets RORC in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, mouse liver tissue,  mouse testis tissue,  rat liver tissue,  rat testis tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Nuclear receptors retinoic acid receptor-related orphan receptor gamma (RORγ or RORc, also known as NR1F3) was the third and most recent ROR group member to be discovered, following the prior disclosures of RORα (RORa or NR1F1) and RORβ (RORb or NR1F2) (PMID:24502334). Studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.RORC has 2 isoforms with the MW of 56 kDa and 58 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31783 Product name: Recombinant human RORC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-320 aa of BC031554 Sequence: DLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERC Predict reactive species\nFull Name: RAR-related orphan receptor C\nCalculated Molecular Weight: 518 aa, 58 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC031554\nGene Symbol: RORC\nGene ID (NCBI): 6097\nRRID: AB_2935489\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P51449\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869427421353,"sku":"29910-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29910-1-ap","provider":"Iright","version":"1.0","type":"link"}