{"product_id":"proteintech-29914-1-ap","title":"Proteintech, 29914-1-AP, CD45 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD45 (29914-1-AP) by Proteintech is a Polyclonal antibody targeting CD45 in WB, IHC, ELISA applications with reactivity to human samples\n29914-1-AP targets CD45 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, Raji cells,  Ramos cells\nPositive IHC detected in: human tonsillitis tissue, human liver cancer tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD45, also known as leukocyte common antigen (LCA), B220, and T200, is a 180-240 kD single-chain type I membrane glycoprotein. It is a tyrosine phosphatase expressed on the plasma membrane of all hematopoietic cells, except erythrocytes and platelets. CD45 is a signaling molecule that regulates a variety of cellular processes including cell growth, differentiation, cell cycle, and oncogenic transformation. CD45 is one of the best negative selection markers for characterizing and\/or isolating human mesenchymal stem cells from bone marrow and other sources. Along with the positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31286 Product name: Recombinant human CD45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 172-493 aa of BC014239 Sequence: TPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKD Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, C\nCalculated Molecular Weight: 1304 aa, 147 kDa\nObserved Molecular Weight: 180-250 kDa\nGenBank Accession Number: BC014239\nGene Symbol: CD45\nGene ID (NCBI): 5788\nENSEMBL Gene ID: ENSG00000081237\nRRID: AB_3086187\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08575\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869653160105,"sku":"29914-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29914-1-ap","provider":"Iright","version":"1.0","type":"link"}