{"product_id":"proteintech-29921-1-ap","title":"Proteintech, 29921-1-AP, OTUD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OTUD1 (29921-1-AP) by Proteintech is a Polyclonal antibody targeting OTUD1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n29921-1-AP targets OTUD1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, A549 cells\nPositive IHC detected in: human cervical cancer tissue, human ovary tumor tissue,  mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOTUD1, OTU domain-containing protein 1, is a deubiquitinating enzyme that specifically hydrolyzes 'Lys-63'-linked polyubiquitin to monoubiquitin (PMID: 23827681). OTUD1-mediated deubiquitination prevents activation of the ribosome quality control and subsequent dissociation of ribosomes and stimulates formation of polysomes and translation (PMID: 36445135). OTUD1 is a colon-specific deubiquitinase that expressed in normal colonic epithelium goblet cells (PMID: 36910614).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31996 Product name: Recombinant human OTUD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-431 aa of Sequence: SSAAEPVIVSRSDPRDEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADHLDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRPSIWLSWLSNGH Predict reactive species\nFull Name: OTU domain containing 1\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 50-55 kDa\nGene Symbol: OTUD1\nGene ID (NCBI): 220213\nRRID: AB_3086190\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VV17\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869006123177,"sku":"29921-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29921-1-ap","provider":"Iright","version":"1.0","type":"link"}