{"product_id":"proteintech-29930-1-ap","title":"Proteintech, 29930-1-AP, SPATS2L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPATS2L (29930-1-AP) by Proteintech is a Polyclonal antibody targeting SPATS2L in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human,  mouse,  rat samples\n29930-1-AP targets SPATS2L in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human lung cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPATS2L encodes spermatogenesis associated and serine-rich 2-like protein, also named DNAPTP6 (DNA polymerase transactivated protein 6) in human (PMID:11230166). SPATS2L acts as an important regulator of β2-adrenergic receptor down-regulation (PubMed: 25562107). MiR-1269a down-regulates the expression of SPATS2L and LRP6, thereby inhibiting the proliferation of liver cancer cells (PMID: 28081866, PMID:35252180). SPATS2L has several isoforms by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31157 Product name: Recombinant human SPATS2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 290-488 aa of BC018736 Sequence: NYSSRTPCSSLLPLLNAHAATSGKQSNFSRKSSTHNKPSEGKAANPKMVSSLPSTADPSHQTMPANKQNGSSNQRRRFNPQYHNNRLNGPAKSQGSGNEAEPLGKGNSRHEHRRQPHNGFRPKNKGGAKNQEASLGMKTPEAPAHSEKPRRRQHAADTSEARPFRGSVGRVSQCNLCPTRIEVSTDAAVLSVPAVTLVA Predict reactive species\nFull Name: viral DNA polymerase-transactivated protein 6\nCalculated Molecular Weight: 488 aa, 54 kDa\nObserved Molecular Weight: 54-65 kDa\nGenBank Accession Number: BC018736\nGene Symbol: SPATS2L\nGene ID (NCBI): 26010\nRRID: AB_2923620\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NUQ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887814135977,"sku":"29930-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29930-1-ap","provider":"Iright","version":"1.0","type":"link"}