{"product_id":"proteintech-29949-1-ap","title":"Proteintech, 29949-1-AP, INPP5J Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INPP5J (29949-1-AP) by Proteintech is a Polyclonal antibody targeting INPP5J in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n29949-1-AP targets INPP5J in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  MCF-7 cells,  mouse heart tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINPP5J(Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A) is also named as PIB5PA, PIPP and belongs to the inositol 1,4,5-trisphosphate 5-phosphatase type II family. INPP5J is a key signalling molecule that regulates dendritic outgrowth through activation of small GTPase signalling via interaction between FRMPD4 and ARHGEF7. It can control the resting membrane potential through a specific ion-channel-receptor-ligand interaction that brings about a large conformational change, analogous to neurotransmitter activation of ion channels at synapses. (PMID:22595022). This protein has 3 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29242 Product name: Recombinant human INPP5J protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-150 aa of BC109288 Sequence: MALPRLGTQSTGPGRCLSPNLQAQEAPAPVTTSSSTSTLSSSPWSAQPTWKSDPGFRITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYH Predict reactive species\nFull Name: inositol polyphosphate-5-phosphatase J\nCalculated Molecular Weight: 1006 aa, 107 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC109288\nGene Symbol: INPP5J\nGene ID (NCBI): 27124\nRRID: AB_2918353\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15735\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887684735145,"sku":"29949-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29949-1-ap","provider":"Iright","version":"1.0","type":"link"}