{"product_id":"proteintech-29965-1-ap","title":"Proteintech, 29965-1-AP, PCDH19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCDH19 (29965-1-AP) by Proteintech is a Polyclonal antibody targeting PCDH19 in WB, ELISA applications with reactivity to human, mouse, rat samples\n29965-1-AP targets PCDH19 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCDH19 is a transmembrane protein and member of the protocadherin family. It is encoded by the X-chromosome and more than 200 mutations have been linked to the neurodevelopmental PCDH-clustering epilepsy (PCDH19-CE) syndrome. PCDH19 is a member of the non-clustered δ2-type protocadherins, has 6 cadherin repeats in the extracellular part, and a cytoplasmic tail containing two conserved domains (CM1 and CM2) (PMID: 36389226).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32302 Product name: Recombinant human PCDH19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 850-1040 aa of NM_001105243.1 Sequence: HHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLEGNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHDQNEGFHCREECRILGHSDRCWMPRNPMPIRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGKDVSDHPAEERPTLKGKRTVD* Predict reactive species\nFull Name: protocadherin 19\nCalculated Molecular Weight: 126 kDa\nObserved Molecular Weight: 126 kDa\nGenBank Accession Number: NM_001105243.1\nGene Symbol: PCDH19\nGene ID (NCBI): 57526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAB3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887751975081,"sku":"29965-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29965-1-ap","provider":"Iright","version":"1.0","type":"link"}