{"product_id":"proteintech-29977-1-ap","title":"Proteintech, 29977-1-AP, KDM4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KDM4A (29977-1-AP) by Proteintech is a Polyclonal antibody targeting KDM4A in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples\n29977-1-AP targets KDM4A in WB, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse lung tissue,  MCF-7 cells,  MDA-MB-231 cells,  NCl-H1299 cells\nPositive IP detected in: MCF-7 cells, A549 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31992 Product name: Recombinant human KDM4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 584-720 aa of BC002558 Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI Predict reactive species\nFull Name: lysine (K)-specific demethylase 4A\nCalculated Molecular Weight: 1064 aa, 121 kDa\nObserved Molecular Weight: 130-150 kDa\nGenBank Accession Number: BC002558\nGene Symbol: KDM4A\nGene ID (NCBI): 9682\nRRID: AB_2923625\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75164\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869413953705,"sku":"29977-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29977-1-ap","provider":"Iright","version":"1.0","type":"link"}