{"product_id":"proteintech-29978-1-ap","title":"Proteintech, 29978-1-AP, HOXA9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXA9 (29978-1-AP) by Proteintech is a Polyclonal antibody targeting HOXA9 in IHC, IP, ELISA applications with reactivity to human samples\n29978-1-AP targets HOXA9 in IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHomeobox protein Hox-A9 (HOXA9) also known as HOX1G,a member of HOX family belonging to the HOXA cluster, is often studied in acute myeloid leukemia (AML), which is linked to proliferation, differentiation, and progenitor self-renewal maintenance. It is located in nucleoplasm and functions as a critical regulator of hematopoiesis, essential for the maintenance of hematopoietic stem cells and their differentiation into myeloid lineages (PMID: 34743404). Many post-transcriptional events including microRNAs, long non-coding RNAs, and epigenetic modification could also determine HOXA9 protein level and function (PMID: 36376832).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32309 Product name: Recombinant human HOXA9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-199 aa of BC010023 Sequence: VYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAAN Predict reactive species\nFull Name: homeobox A9\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC010023\nGene Symbol: HOXA9\nGene ID (NCBI): 3205\nRRID: AB_3086202\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31269\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887670218921,"sku":"29978-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29978-1-ap","provider":"Iright","version":"1.0","type":"link"}