{"product_id":"proteintech-29997-1-ap","title":"Proteintech, 29997-1-AP, WDR73 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR73 (29997-1-AP) by Proteintech is a Polyclonal antibody targeting WDR73 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n29997-1-AP targets WDR73 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse cerebellum tissue,  rat kidney tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDR73 contains multiple WD40 repeat domains that function as scaffolds for the assembly of protein complexes. WDR73 was present in the brain and kidney and was located diffusely in the cytoplasm during interphase but relocalized to spindle poles and astral microtubules during mitosis. WDR73 interacts with microtubules to regulate cell cycle progression, proliferation, and survival in the brain and kidney(PMID: 26070982).  Reduced expression of WDR73 results in abnormalities in the size and morphology of the nucleus. Mutations in WDR73 have been associated with Galloway-Mowat syndrome, which is a rare autosomal recessive disorder that affects both the central nervous system and the kidney (PMID: 25466283).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31818 Product name: Recombinant human WDR73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 112-378 aa of BC063392 Sequence: QVAEDSDVIKAVSTIAVHEKEESLWPRVAVFSTLAPGVLHGARLRSLQVVDLESRKTTYTSDVSDSEELSSLQVLDADTFAFCCASGRLGLVDTRQKWAPLENRSPGPGSGGERWCAEVGSWGQGPGPSIASLGSDGRLCLLDPRDLCHPVSSVQCPVSVPSPDPELLRVTWAPGLKNCLAISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDWVDLCAPR Predict reactive species\nFull Name: WD repeat domain 73\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC063392\nGene Symbol: WDR73\nGene ID (NCBI): 84942\nRRID: AB_3086206\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6P4I2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869793374377,"sku":"29997-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29997-1-ap","provider":"Iright","version":"1.0","type":"link"}