{"product_id":"proteintech-29998-1-ap","title":"Proteintech, 29998-1-AP, MBD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MBD1 (29998-1-AP) by Proteintech is a Polyclonal antibody targeting MBD1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n29998-1-AP targets MBD1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMBD1, also known as RFT, PCM1, CXXC3, is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). MBD1 is a transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. MBD1 acts as a transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. Isoform 1 and isoform 2 can repress transcription from unmethylated promoters (PMID: 12665582, 14610093, 16757475).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31424 Product name: Recombinant human MBD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 393-605 aa of NM_015846 Sequence: SEDGAGSPPPYRRRKRPSSARRHHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDEWTPGTAVLTSPVLVPGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKPGARKQ Predict reactive species\nFull Name: methyl-CpG binding domain protein 1\nCalculated Molecular Weight: 67KD\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: NM_015846\nGene Symbol: MBD1\nGene ID (NCBI): 4152\nRRID: AB_2935497\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UIS9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869707423913,"sku":"29998-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-29998-1-ap","provider":"Iright","version":"1.0","type":"link"}