{"product_id":"proteintech-30010-1-ap","title":"Proteintech, 30010-1-AP, ITGBL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ITGBL1 (30010-1-AP) by Proteintech is a Polyclonal antibody targeting ITGBL1 in WB, ELISA applications with reactivity to human samples\n30010-1-AP targets ITGBL1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-231 cells,  OVCAR-3 cells,  SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrin beta-like protein 1 (ITGBL1), also named as TIED or OSCP, is a secreted protein that contains ten tandem EGF-like repeats strikingly similar to those found in the cysteine-rich \"stalk-like\" structure of integrin beta subunits (PMID: 10051402). ITGBL1 participates in the regulation of fibrogenesis via interactions with transforming growth factor beta 1 (PMID: 28262670). ITGBL1 is also involved in the development and metastasis of many tumors (PMID: 32211321; 29772438; 26060017; 31190876).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31989 Product name: Recombinant human ITGBL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-374 aa of BC036788 Sequence: VCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGV Predict reactive species\nFull Name: integrin, beta-like 1 (with EGF-like repeat domains)\nCalculated Molecular Weight: 494 aa, 54 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC036788\nGene Symbol: ITGBL1\nGene ID (NCBI): 9358\nRRID: AB_3086208\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95965\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887687815337,"sku":"30010-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30010-1-ap","provider":"Iright","version":"1.0","type":"link"}