{"product_id":"proteintech-30025-1-ap","title":"Proteintech, 30025-1-AP, CNDP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNDP2 (30025-1-AP) by Proteintech is a Polyclonal antibody targeting CNDP2 in WB, ELISA applications with reactivity to Human samples\n30025-1-AP targets CNDP2 in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HL-60 cells,  Jurkat cells,  PC-3 cells,  U-251 cells,  U-937 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarnosine dipeptidase II (CNDP2) catalyzes the peptide bond hydrolysis in dipeptides, displaying a non-redundant activity toward threonyl dipeptides. It has high dipeptidase activity toward cysteinyl glycine, an intermediate metabolite in glutathione metabolism (PubMed:19346245, PubMed:12473676). Metabolizes N-lactoyl-amino acids, both through hydrolysis to form lactic acid and amino acids, as well as through their formation by reverse proteolysis (PubMed:25964343). CNDP2 has 2 isoforms with a molecular weight of 53 and 44 kDa.\nThe isoform 1 is ubiquitously expressed with higher levels in the kidney and liver (at protein level) and expressed in peripheral blood leukocytes (PubMed:12473676). It is also expressed in gastric mucosa and down-regulated in gastric cancer mucosal tissues (at the protein level) (PubMed:24395568). Isoform 2 is broadly expressed in fetal tissues and expressed in the adult liver and placenta. (PMID: 17121880).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32312 Product name: Recombinant human CNDP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-305 aa of BC001375 Sequence: TGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSHKKDIL Predict reactive species\nFull Name: CNDP dipeptidase 2 (metallopeptidase M20 family)\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 44-53 kDa\nGenBank Accession Number: BC001375\nGene Symbol: CNDP2\nGene ID (NCBI): 55748\nRRID: AB_2935503\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96KP4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886662013097,"sku":"30025-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30025-1-ap","provider":"Iright","version":"1.0","type":"link"}