{"product_id":"proteintech-30028-1-ap","title":"Proteintech, 30028-1-AP, BCKDHA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCKDHA (30028-1-AP) by Proteintech is a Polyclonal antibody targeting BCKDHA in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n30028-1-AP targets BCKDHA in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, HepG2 cells,  rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nbranched chain keto acid dehydrogenase E1, alpha polypeptide (BCKDHA), the gene encoding the regulated subunit of BCKDC was only one of two primary susceptibility genes identified that affected the risk of both type 2 diabetes mellitus (T2DM) and obesity (PMID: 25287287). BIX01294 transcriptionally downregulated the transcription of BCKDHA, which is essential for fueling the tricarboxylic acid (TCA) cycle. Studies have shown that KDM3A, a Jumonji histone demethylase, epigenetically regulates BCKDHA expression by binding to the BCKDHA gene promoter (PMID: 34876693). Moreover, at least four genes including BCKDHA, branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB), dihydrolipoamide dehydrogenase (DLD), and dihydrolipoamide branched chain transacylase E2 (DBT) have been reported to be the causative gene for Maple syrup urine disease (MSUD) (PMID: 34187135).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32613 Product name: Recombinant human BCKDHA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 264-445 aa of BC008933 Sequence: CRNNGYAISTPTSEQYRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRSVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK Predict reactive species\nFull Name: branched chain keto acid dehydrogenase E1, alpha polypeptide\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 42-50 kDa\nGenBank Accession Number: BC008933\nGene Symbol: BCKDHA\nGene ID (NCBI): 593\nRRID: AB_2935504\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12694\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869394718889,"sku":"30028-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30028-1-ap","provider":"Iright","version":"1.0","type":"link"}