{"product_id":"proteintech-30030-1-ap","title":"Proteintech, 30030-1-AP, AP2A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP2A1 (30030-1-AP) by Proteintech is a Polyclonal antibody targeting AP2A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n30030-1-AP targets AP2A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  MCF-7 cells,  SKOV-3 cells,  SH-SY5Y cells,  mouse kidney tissue,  rat kidney tissue,  mouse kidney cells,  rat kidney cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP2A1 encodes adaptor protein complex 2 (AP-2) subunit alpha-1, which is a 100 kDa coated vesicle protein. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is involved in clathrin-dependent endocytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32232 Product name: Recombinant human AP2A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 616-724 aa of BC014214 Sequence: LKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADLLGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNK Predict reactive species\nFull Name: adaptor-related protein complex 2, alpha 1 subunit\nCalculated Molecular Weight: 977 aa, 108 kDa\nObserved Molecular Weight: 108 kDa\nGenBank Accession Number: BC014214\nGene Symbol: AP2A1\nGene ID (NCBI): 160\nRRID: AB_2935505\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95782\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971249833,"sku":"30030-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30030-1-ap","provider":"Iright","version":"1.0","type":"link"}