{"product_id":"proteintech-30035-1-ap","title":"Proteintech, 30035-1-AP, ATP2B1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP2B1 (30035-1-AP) by Proteintech is a Polyclonal antibody targeting ATP2B1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n30035-1-AP targets ATP2B1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated mouse brain tissue\nPositive IHC detected in: human pancreas cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32423 Product name: Recombinant human ATP2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-89 aa of NM_001001323.1 Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF Predict reactive species\nFull Name: ATPase, Ca++ transporting, plasma membrane 1\nCalculated Molecular Weight: 135 kDa\nObserved Molecular Weight: 130-180 kDa\nGenBank Accession Number: NM_001001323.1\nGene Symbol: ATP2B1\nGene ID (NCBI): 490\nRRID: AB_3086214\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20020\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885106679977,"sku":"30035-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30035-1-ap","provider":"Iright","version":"1.0","type":"link"}