{"product_id":"proteintech-30046-1-ap","title":"Proteintech, 30046-1-AP, BAHCC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAHCC1 (30046-1-AP) by Proteintech is a Polyclonal antibody targeting BAHCC1 in IHC, IF\/ICC, ELISA applications with reactivity to Human, mouse, rat samples\n30046-1-AP targets BAHCC1 in IHC, IF\/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, rat brain tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAHCC1 (BAH and coiled-coil domain-containing protein 1) is also named as BAHD2, KIAA1447 and BAH domain-containing protein 2. BAHCC1 is a transcriptional regulator controlling expression of E2F\/KLF-dependent cell-cycle and DNA-repair genes. BAHCC1 associates with BRG1-containing remodeling complexes at the promoters of these genes. BAHCC1 silencing leads to decreased cell proliferation and delayed DNA repair. Consequently, BAHCC1 deficiency cooperates with PARP inhibition to induce melanoma cell death (PMID: 37924516). depletion of BAHCC1, or disruption of the BAHCC1BAH-H3K27me3 interaction, causes derepression of H3K27me3-targeted genes that are involved in tumor suppression and cell differentiation, leading to suppression of oncogenesis (PMID: 33139953).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32599 Product name: Recombinant human BAHCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1518-1614 aa of NM_001291324.1 Sequence: SLGLLCAELRGGSGGEPAKKRSKLERSVYAGLQTASVEKAQCKKSSCQGGLAPSVAHRVAQLKPKVKSKGLPTGLSSFQQKEATPGGRIREKLSRAK Predict reactive species\nFull Name: BAH domain and coiled-coil containing 1\nCalculated Molecular Weight: 280 kDa\nObserved Molecular Weight: 280 kDa\nGenBank Accession Number: NM_001291324.1\nGene Symbol: BAHCC1\nGene ID (NCBI): 57597\nRRID: AB_3086218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P281\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885170938025,"sku":"30046-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30046-1-ap","provider":"Iright","version":"1.0","type":"link"}