{"product_id":"proteintech-30072-1-ap","title":"Proteintech, 30072-1-AP, TSPAN13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSPAN13 (30072-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN13 in WB, ELISA applications with reactivity to human samples\n30072-1-AP targets TSPAN13 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSPAN13 (also known as NET6 or TM4SF13) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. Overexpression of TSPAN13 has been reported in prostate cancer, suggesting that TSPAN13 may have an important role in the progression of prostate cancer (PMID: 19148481). The experimentally determined molecular mass of 28-35 kDa is larger than the calcular molecular weight of 22 kDa, which could be a result of post-translational modifications (PMID: 23648579).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32345 Product name: Recombinant human TSPAN13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-167 aa of BC033863 Sequence: CACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLR Predict reactive species\nFull Name: tetraspanin 13\nCalculated Molecular Weight: 204 aa, 22 kDa\nObserved Molecular Weight: 28-35 kDa\nGenBank Accession Number: BC033863\nGene Symbol: TSPAN13\nGene ID (NCBI): 27075\nRRID: AB_2935509\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95857\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887909032105,"sku":"30072-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30072-1-ap","provider":"Iright","version":"1.0","type":"link"}