{"product_id":"proteintech-30118-1-ap","title":"Proteintech, 30118-1-AP, BST2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BST2 (30118-1-AP) by Proteintech is a Polyclonal antibody targeting BST2 in WB, IF-P, ELISA applications with reactivity to Human, mouse samples\n30118-1-AP targets BST2 in WB, IF-P, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBST2, also named as CD317 and Tetherin, belongs to the tetherin family. It may be involved in the sorting of secreted proteins and it is involved in pre-B-cell growth. BST2 is an antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. BST2 may play a role in B-cell activation in rheumatoid arthritis. It is recently identified interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. BST2 is a plasma membrane proteins, tetherin inhibits virion particle release from infected cells. BST2 is effective against retroviruses and flavoviruses whilst IFITMs disrupt influenza and flavivirus infection. Observed MW of BST2 is 30-36 kDa (PMID: 19196977; 21237475).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32333 Product name: Recombinant human BST2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 49-161 aa of BC033873 Sequence: NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS Predict reactive species\nFull Name: bone marrow stromal cell antigen 2\nCalculated Molecular Weight: 180 aa, 20 kDa\nObserved Molecular Weight: 30-36 kDa, 50-70 kDa\nGenBank Accession Number: BC033873\nGene Symbol: BST2\nGene ID (NCBI): 684\nRRID: AB_3086236\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q10589\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885289361577,"sku":"30118-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30118-1-ap","provider":"Iright","version":"1.0","type":"link"}