{"product_id":"proteintech-30131-1-ap","title":"Proteintech, 30131-1-AP, NOX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOX3 (30131-1-AP) by Proteintech is a Polyclonal antibody targeting NOX3 in WB, ELISA applications with reactivity to Human, mouse samples\n30131-1-AP targets NOX3 in WB, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells,  HEK-293 cells,  PC-12 cells,  mouse kidney tissue,  mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOX3 is a member of NADPH oxidase which constitutively produces superoxide upon formation of a complex with CYBA\/p22phox. NOX3 plays a role in the biogenesis of otoconia\/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. The antibody is specific to NOX3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32601 Product name: Recombinant human NOX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-395 aa of NM_015718 Sequence: GRIVRGQTQDSLSLHNITFCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVSHPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWTAALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTD Predict reactive species\nFull Name: NADPH oxidase 3\nCalculated Molecular Weight: 64kd\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: NM_015718\nGene Symbol: NOX3\nGene ID (NCBI): 50508\nRRID: AB_2935517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HBY0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869720367273,"sku":"30131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30131-1-ap","provider":"Iright","version":"1.0","type":"link"}