{"product_id":"proteintech-30136-1-ap","title":"Proteintech, 30136-1-AP, CETP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CETP (30136-1-AP) by Proteintech is a Polyclonal antibody targeting CETP in WB, ELISA applications with reactivity to Human samples\n30136-1-AP targets CETP in WB, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HT-29 cells,  HepG2 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCholesteryl ester transfer protein (CETP) is a plasma glycoprotein which transfers cholesteryl esters, triglycerides, and phospholipids between lipoproteins. In plasma, CETP is mainly associated with HDL particles and catalyzes the transfer of cholesteryl esters from HDL to apolipoprotein (apo) B-containing plasma lipoproteins. Low plasma concentrations of high-density lipoprotein-cholesterol (HDL-C) have long been recognized as a major, independent cardiovascular disease (CVD) risk factor. It demonstrated that altered level of plasma CETP was associated with the increased risk of CVD (PMID: 17991755, PMID: 23477743). CETP can be detected a 70 kDa isoform by glycosylation (PMID: 3281933,PMID: 22056562). It also can be detected 100 kDa dimer (PMID: 7744792).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32722 Product name: Recombinant human CETP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-386 aa of BC025739 Sequence: TQLTCDSGRVRTDAPDCYLSFHKLLLHLQGEREPGWIKQLFTNFISFTLKLVLKGQICKEINVISNIMADFVQTRAASILSDGDIGVDISLTGDPVITASYLESHHKGHFIYKNVSEDLPLPTFSPTLLGDSRMLYFWFSERVFHSLAKVAFQDGRLMLSLMGDEFKAVLETWGFNTNQEIFQEVVGGFPSQAQVTVHCLKMPKISCQNKGVVVNSSVMVKFLFPRPDQQHSVAYTFEEDIVT Predict reactive species\nFull Name: cholesteryl ester transfer protein, plasma\nCalculated Molecular Weight: 493 aa, 55 kDa\nObserved Molecular Weight: 55 kDa,70 kDa\nGenBank Accession Number: BC025739\nGene Symbol: CETP\nGene ID (NCBI): 1071\nRRID: AB_3086242\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11597\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886487326889,"sku":"30136-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30136-1-ap","provider":"Iright","version":"1.0","type":"link"}