{"product_id":"proteintech-30141-1-ap","title":"Proteintech, 30141-1-AP, KIF13B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIF13B (30141-1-AP) by Proteintech is a Polyclonal antibody targeting KIF13B in WB, IHC, IP, ELISA applications with reactivity to human samples\n30141-1-AP targets KIF13B in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HeLa cells,  Jurkat cells,  K-562 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIF13B, Also known as GAKIN, is a 250-kD phosphoprotein. KIF13B contains a consensus ATP\/GTP-binding motif within its N-terminal motor domain; a stalk domain containing several short alpha-helical segments; and a CAP-gly motif in its C terminus characteristic of microtubule-based cytoskeleton components(PMID: 10859302).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30876 Product name: Recombinant human KIF13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1648-1826 aa of NM_015254 Sequence: VRRVRASELRSFSRMLAGDPGCSPGAEGNAPAPGAGGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSGKNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATNLASLTAALAKADRSHKNPENRKSWAS Predict reactive species\nFull Name: kinesin family member 13B\nCalculated Molecular Weight: 203 kDa\nObserved Molecular Weight: 250 kDa\nGenBank Accession Number: NM_015254\nGene Symbol: KIF13B\nGene ID (NCBI): 23303\nRRID: AB_3086245\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQT8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869700837545,"sku":"30141-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30141-1-ap","provider":"Iright","version":"1.0","type":"link"}