{"product_id":"proteintech-30145-1-ap","title":"Proteintech, 30145-1-AP, MLKL  Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MLKL  (30145-1-AP) by Proteintech is a Polyclonal antibody targeting MLKL  in WB, IF\/ICC, ELISA applications with reactivity to mouse, rat samples\n30145-1-AP targets MLKL  in WB, IF\/ICC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, HSC-T6 cells,  4T1 cells\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMixed lineage kinase domain-like pseudokinase (Mlkl) belongs to the protein kinase superfamily and has two MWs of 54 and 30 kDa. Mlkl plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in the necroptosis pathway. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32514 Product name: Recombinant mouse Mlkl protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_001310613 Sequence: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKT Predict reactive species\nFull Name: mixed lineage kinase domain-like\nCalculated Molecular Weight: 54kd\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: NM_001310613\nGene Symbol: Mlkl\nGene ID (NCBI): 74568\nRRID: AB_3086246\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9D2Y4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869559869609,"sku":"30145-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30145-1-ap","provider":"Iright","version":"1.0","type":"link"}