{"product_id":"proteintech-30162-1-ap","title":"Proteintech, 30162-1-AP, FBXO44 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO44 (30162-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO44 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n30162-1-AP targets FBXO44 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO44 is a member of the F-box protein family that shares a function as substrate recognition factors for the SKP1-CUL1-F-box (SCF)-type ubiquitin ligase. Several human FBXs (FBXO2, FBXO6, FBXO17, FBXO27, and FBXO44) share a conserved G domain (also known as FBA domain), which is responsible for recognizing N-glycan moieties by most FBXs in this group except FBXO44. (PMID: 25970626, PMID: 23086937)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32432 Product name: Recombinant human FBXO44 protein Source: e coli. -derived, PKG Tag: GST Domain: 82-122 aa of BC007832 Sequence: LHNPCAEEGFEFWSLDVNGGDEWKVEDLSRDQRKEFPNDQV Predict reactive species\nFull Name: F-box protein 44\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC007832\nGene Symbol: FBXO44\nGene ID (NCBI): 93611\nRRID: AB_3086253\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H4M3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887637057705,"sku":"30162-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30162-1-ap","provider":"Iright","version":"1.0","type":"link"}