{"product_id":"proteintech-30186-1-ap","title":"Proteintech, 30186-1-AP, BRPF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRPF1 (30186-1-AP) by Proteintech is a Polyclonal antibody targeting BRPF1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples\n30186-1-AP targets BRPF1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-12 cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRPF1 (bromodomain and PHD finger-containing protein 1) is also named as BR140. BRPF1 is scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ\/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PMID:16387653, PMID:24065767, PMID:27939640). BRPF1 plays a key role in HBO1 complex by directing KAT7\/HBO1 specificity towards histone H3 'Lys-14' acetylation (H3K14ac) (PMID:24065767). And BRPF1 positively regulates the transcription of RUNX1 and RUNX2 (PMID:18794358).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32828 Product name: Recombinant human BRPF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 741-880 aa of BC053851 Sequence: QAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTDSAAEESSSQETSKGL Predict reactive species\nFull Name: bromodomain and PHD finger containing, 1\nCalculated Molecular Weight: 1220 aa, 138 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC053851\nGene Symbol: BRPF1\nGene ID (NCBI): 7862\nRRID: AB_2935526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55201\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885281398953,"sku":"30186-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30186-1-ap","provider":"Iright","version":"1.0","type":"link"}