{"product_id":"proteintech-30188-1-ap","title":"Proteintech, 30188-1-AP, TASOR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TASOR (30188-1-AP) by Proteintech is a Polyclonal antibody targeting TASOR in WB, IHC, ELISA applications with reactivity to human, mouse samples\n30188-1-AP targets TASOR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTASOR, also known as FAM208A or C3orf63, is the central subunit of the human silencing hub (HUSH) complex. HUSH regulates deposition of the epigenetic mark H3K9me3. TASOR has a catalytically-inactive PARP domain which is necessary for targeted H3K9me3 deposition (PMID: 33009411). TASOR and the RNA deadenylase CCR4-NOT complex scaffold CNOT1 synergistically repress HIV proviral expression (PMID: 35013187). TASOR affects the genome stability during the cellular division and also interacts with methylation complex in adult tissues (PMID: 34272044).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32757 Product name: Recombinant human TASOR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1361-1512 aa of NM_001112736.1 Sequence: GKWQWKVHCKFQKKLKELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIVFLTEKNIKMLSSYTDNGIVVATAEDFMQNFKNLVGYHNSITEENLPQLGANENLESQSALLENDEKDEEDMSLDSG Predict reactive species\nFull Name: chromosome 3 open reading frame 63\nCalculated Molecular Weight: 189 kDa\nObserved Molecular Weight: 189 kDa\nGenBank Accession Number: NM_001112736.1\nGene Symbol: TASOR\nGene ID (NCBI): 23272\nRRID: AB_2935527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UK61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887823016105,"sku":"30188-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30188-1-ap","provider":"Iright","version":"1.0","type":"link"}