{"product_id":"proteintech-30189-1-ap","title":"Proteintech, 30189-1-AP, RASGRP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RASGRP2 (30189-1-AP) by Proteintech is a Polyclonal antibody targeting RASGRP2 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n30189-1-AP targets RASGRP2 in WB, IF\/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MOLT-4 cells,  Raji cells\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRASGRP2, also named as CDC25L and MCG7, belongs to the RASGRP family. It functions as a calcium- and DAG-regulated nucleotide exchange factor specifically activating Rap through the exchange of bound GDP for GTP. RASGRP2 may also activate other GTPases such as RRAS, RRAS2, NRAS, KRAS but not HRAS. RASGRO2 functions in aggregation of platelets and adhesion of T-lymphocytes and neutrophils probably through inside-out integrin activation. It may function in the muscarinic acetylcholine receptor M1\/CHRM1 signaling pathway. The antibody recognizes the C-term of RASGRP2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32762 Product name: Recombinant human RASGRP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 370-609 aa of NM_153819 Sequence: QYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGSAPSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL Predict reactive species\nFull Name: RAS guanyl releasing protein 2 (calcium and DAG-regulated)\nCalculated Molecular Weight: 69kd\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: NM_153819\nGene Symbol: RASGRP2\nGene ID (NCBI): 10235\nRRID: AB_3086257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7LDG7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869749760169,"sku":"30189-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30189-1-ap","provider":"Iright","version":"1.0","type":"link"}