{"product_id":"proteintech-30191-1-ap","title":"Proteintech, 30191-1-AP, PDZD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDZD2 (30191-1-AP) by Proteintech is a Polyclonal antibody targeting PDZD2 in WB, IHC, ELISA applications with reactivity to Human, mouse samples\n30191-1-AP targets PDZD2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDZD2, PDZ-domain containing-2, also named as AIPC, KIAA0300 and PDZK3, is associated with the early promotion of prostate tumoregenesis. The antibody recognizes near the N-term of PDZD2. PDZD2 is a novel factor that affects the growth and differentiation of human fetal pancreatic progenitor cells. The secreted form sPDZD2 can be detected 37 kDa (PMID: 18037333).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32900 Product name: Recombinant human PDZD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2519-2641 aa of NM_178140 Sequence: RRSPGPPAGGVSCPEKGGNRACPGGSGPKTSAAETPSSASDTGEAAQDLPFRRSWSVNLDQLLVSAGDQQRLQSVLSSVGSKSTILTLIQEAKAQSENEEDVCFIVLNRKEGSGLGFSVAGGT Predict reactive species\nFull Name: PDZ domain containing 2\nCalculated Molecular Weight: 302 kDa\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: NM_178140\nGene Symbol: PDZD2\nGene ID (NCBI): 23037\nRRID: AB_3086258\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15018\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887756103849,"sku":"30191-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30191-1-ap","provider":"Iright","version":"1.0","type":"link"}