{"product_id":"proteintech-30194-1-ap","title":"Proteintech, 30194-1-AP, IL-1RL1\/ST2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-1RL1\/ST2 (30194-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1RL1\/ST2 in WB, FC, ELISA applications with reactivity to human samples\n30194-1-AP targets IL-1RL1\/ST2 in WB, FC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, human placenta tissue\nPositive FC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nFlow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nST2, also known as IL1RL1, is a member of the IL-1 superfamily and serves as the receptor for IL-33. It plays a major role in immune and inflammatory responses. ST2 is expressed by various types of immune cells including Th2 cells, mast cells, type 2 innate lymphoid cells, eosinophils, basophils, NK cells, and non-immune cells, including cardiomyocytes. Two forms of ST2 exist: a membrane-bound form and a soluble form (sST2). The membrane-bound form activates the MyD88\/NF-κB signaling pathway to enhance mast cell, Th2, regulatory T cell (Treg), and innate lymphoid cell type 2 functions. sST2 acts as a decoy receptor. (PMID: 27055914; 23999434; 28484466)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0116 Product name: Recombinant Human ST2\/IL-1 RL1 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 19-328 aa of BC030975 Sequence: KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPSKECF Predict reactive species\nFull Name: interleukin 1 receptor-like 1\nCalculated Molecular Weight: 63 kDa, 37 kDa, 30 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC030975\nGene Symbol: IL1RL1\nGene ID (NCBI): 9173\nRRID: AB_3086259\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01638\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887679754409,"sku":"30194-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30194-1-ap","provider":"Iright","version":"1.0","type":"link"}