{"product_id":"proteintech-30205-1-ap","title":"Proteintech, 30205-1-AP, E-selectin \/ CD62E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe E-selectin \/ CD62E (30205-1-AP) by Proteintech is a Polyclonal antibody targeting E-selectin \/ CD62E in IHC, IF-P, ELISA applications with reactivity to Human samples\n30205-1-AP targets E-selectin \/ CD62E in IHC, IF-P, ELISA applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human appendicitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nE-selectin, also known as ELAM-1 or CD62E, is a member of the selectin family of adhesion molecules that also includes L-selectin and P-selectin. E-selectin is an inducible endothelial cell surface molecule. Its expression on endothelial cells is transcriptionally upregulated by various proinflammatory substances such as IL-1, TNFα and lipopolysaccharide (LPS). Besides, it can be secreted by endothelial cells, and can be detected in a soluble form (sE-selectin) in serum. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. (PMID: 2827173; 1382417; 8943958)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31820 Product name: Recombinant human SELE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-371 aa of BC142711 Sequence: KCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALS Predict reactive species\nFull Name: selectin E\nCalculated Molecular Weight: 610 aa, 67 kDa\nGenBank Accession Number: BC142711\nGene Symbol: CD62E\nGene ID (NCBI): 6401\nRRID: AB_2935530\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P16581\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887627882665,"sku":"30205-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30205-1-ap","provider":"Iright","version":"1.0","type":"link"}