{"product_id":"proteintech-30206-1-ap","title":"Proteintech, 30206-1-AP, LRP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRP1 (30206-1-AP) by Proteintech is a Polyclonal antibody targeting LRP1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n30206-1-AP targets LRP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse liver tissue,  HeLa cells,  mouse lung tissue,  rat liver tissue,  rat lung tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLRP1 (Prolow-density lipoprotein receptor-related protein 1), also known as A2MR, APOER and CD91, is a type I transmembrane protein that belongs to the LDLR family. LRP1 is synthesized as a transmembrane glycosylated precursor of 600 kDa, and is subsequently cleaved to generate a large 515-kDa N-terminal extracellular subunit and an 85-kDa C-terminal transmembrane subunit, which are noncovalently associated with one another (PMID: 2112085; 8546712). LRP1 is a multifunctional receptor involved in the clearance of a large number of diverse ligands and modulating various cellular processes. LRP1 is implicated in conditions such as atherosclerosis, cancer and neurodegenerative diseases (PMID: 28381441). This antibody is raised against 20-170 aa of human LRP1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32507 Product name: Recombinant human LRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-170 aa of BC045107 Sequence: AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGS Predict reactive species\nFull Name: low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor)\nCalculated Molecular Weight: 505 kDa\nObserved Molecular Weight: 505 kDa\nGenBank Accession Number: BC045107\nGene Symbol: LRP1\nGene ID (NCBI): 4035\nRRID: AB_3086263\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07954\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869704343721,"sku":"30206-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30206-1-ap","provider":"Iright","version":"1.0","type":"link"}