{"product_id":"proteintech-30214-1-ap","title":"Proteintech, 30214-1-AP, ACSL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACSL3 (30214-1-AP) by Proteintech is a Polyclonal antibody targeting ACSL3 in WB, IP, ELISA applications with reactivity to Human, mouse samples\n30214-1-AP targets ACSL3 in WB, IP, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: DU 145 cells, HuH-7 cells,  LNCaP cells,  MKN-45 cells,  mouse kidney tissue\nPositive IP detected in: LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACSL3, also named as ACS3, FACL3 and LACS3, belongs to the ATP-dependent AMP-binding enzyme family. Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 mediates hepatic lipogenesis. Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates. Has mainly an anabolic role in energy metabolism. Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins). The antibody is specific to ACSL3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33005 Product name: Recombinant human ACSL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 602-675 aa of BC041692 Sequence: KNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFE Predict reactive species\nFull Name: acyl-CoA synthetase long-chain family member 3\nCalculated Molecular Weight: 80 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC041692\nGene Symbol: ACSL3\nGene ID (NCBI): 2181\nRRID: AB_2935532\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95573\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869630910633,"sku":"30214-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30214-1-ap","provider":"Iright","version":"1.0","type":"link"}