{"product_id":"proteintech-30221-1-ap","title":"Proteintech, 30221-1-AP, TOE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOE1 (30221-1-AP) by Proteintech is a Polyclonal antibody targeting TOE1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n30221-1-AP targets TOE1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOE1, also known as hCaf1z, belongs to the DEDD family of deadenylases. TOE1 was initially identified as a direct target gene of ERG1, an immediate early transcription factor. TOE1 encodes an Asp-Glu-Asp-Asp deadenylase that specifically localizes to Cajal bodies in the nucleus, where assembly and maturation of small nuclear ribonucleoprotein particles, and telomerase ribonucleoprotein complex take place (PMID: 36257135). TOE1 has 2 isoforms with the molecular mass of 48 and 57 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31470 Product name: Recombinant human TOE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 318-510 aa of BC009364 Sequence: SHDIDLIIDTDEAAAEDKRRRRRRREKRKRALLNLPGTQTSGEAKDGPPKKQVCGDSIKPEETEQEVAADETRNLPHSKQGNKNDLEMGIKAARPEIADRATSEVPGSQASPNPVPGDGLHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGSS Predict reactive species\nFull Name: target of EGR1, member 1 (nuclear)\nCalculated Molecular Weight: 510 aa, 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC009364\nGene Symbol: TOE1\nGene ID (NCBI): 114034\nRRID: AB_2935533\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96GM8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835140265,"sku":"30221-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30221-1-ap","provider":"Iright","version":"1.0","type":"link"}