{"product_id":"proteintech-30222-1-ap","title":"Proteintech, 30222-1-AP, LCMT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LCMT1 (30222-1-AP) by Proteintech is a Polyclonal antibody targeting LCMT1 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples\n30222-1-AP targets LCMT1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HeLa cells,  HepG2 cellls,  MCF-7 cells,  U-87 MG cells\nPositive IHC detected in: mouse uterus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine carboxyl methyltransferase 1 (LCMT1) belongs to the methyltransferase superfamily (LCMT family). It methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha-leucine ester residues. LCMT1 has 3 isoforms with the MW of 38 kDa, 41 kDa, and 32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32038 Product name: Recombinant human LCMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 179-299 aa of BC001214 Sequence: EEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESL Predict reactive species\nFull Name: leucine carboxyl methyltransferase 1\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 38-41 kDa\nGenBank Accession Number: BC001214\nGene Symbol: LCMT1\nGene ID (NCBI): 51451\nRRID: AB_2935534\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UIC8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887702102185,"sku":"30222-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30222-1-ap","provider":"Iright","version":"1.0","type":"link"}