{"product_id":"proteintech-30239-1-ap","title":"Proteintech, 30239-1-AP, USP50 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP50 (30239-1-AP) by Proteintech is a Polyclonal antibody targeting USP50 in WB, ELISA applications with reactivity to human, mouse samples\n30239-1-AP targets USP50 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP50 (Ubiquitin Specific Peptidase 50) is a deubiquitinating enzyme that belongs to the USP family. It plays a key role in DNA replication, genome stability and cell cycle regulation. Recent studies have found that USP50 maintains the stability of the DNA replication process and telomere integrity by regulating the use of nuclease and deconjugating enzymes. During replication, USP50 was able to inhibit the harmful DNA2 nuclease activity and substitute the use of RecQ deconjugase, thereby preventing replication fork stalling and DNA damage.\n\nIn addition, USP50 plays a role in the cell cycle G2\/M phase transition, assembly of the NLRP3 inflammasome complex, and organization of nuclear speckles. Its loss of function leads to DNA double-strand breaks and telomere instability in cells under replication stress. These findings provide new insights into the understanding of the pathogenesis of genetic diseases and may offer potential targets for the treatment of diseases such as cancer and premature aging.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag31275 Product name: Recombinant human USP50 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 145-290 aa of BC146493 Sequence: NELHEALKKYHYSRRRSYEKGSTQRCCRKWITTETSIITQLFEEQLNYSIVCLKCEKCTYKNEVFTVFSLPIPSKYECSLRDCLQCFFQQDALTWNNEIHCSFCETKQETAVRASISKAPKIIIFHLKRFDIQGTTKRKLRTDIHY Predict reactive species\nFull Name: ubiquitin specific peptidase 50\nCalculated Molecular Weight: 339 aa, 39 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC146493\nGene Symbol: USP50\nGene ID (NCBI): 373509\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q70EL3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887918796969,"sku":"30239-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30239-1-ap","provider":"Iright","version":"1.0","type":"link"}