{"product_id":"proteintech-30251-1-ap","title":"Proteintech, 30251-1-AP, CRTAC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CRTAC1 (30251-1-AP) by Proteintech is a Polyclonal antibody targeting CRTAC1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples\n30251-1-AP targets CRTAC1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCRTAC1 (Cartilage acidic protein 1) is also named as ASPIC and 68 kDa chondrocyte-expressed protein (CEP-68). Cartilage acidic protein 1 (CRTAC1), a novel human marker which allowed discrimination of human chondrocytes from osteoblasts and mesenchymal stem cells (PMID: 17074475). CRTAC1 is a glycosylated calcium-binding extracellular matrix protein (PMID: 37796703). CRTAC1 acquired an alternate last exon from the tail-to-tail oriented neighbouring gene in humans resulting in the glycosylated isoform CRTAC1-A which represents a new extracellular matrix molecule of articular cartilage (PMID: 17074475). CRTAC1 was downregulated in bladder cancer tissues and cells (PMID: 34818994).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, rat\nCited Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32963 Product name: Recombinant human CRTAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-332 aa of BC034245 Sequence: VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP Predict reactive species\nFull Name: cartilage acidic protein 1\nCalculated Molecular Weight: 661 aa, 71 kDa\nObserved Molecular Weight: 71-100 kDa\nGenBank Accession Number: BC034245\nGene Symbol: CRTAC1\nGene ID (NCBI): 55118\nRRID: AB_3086281\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ79\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869663056041,"sku":"30251-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30251-1-ap","provider":"Iright","version":"1.0","type":"link"}