{"product_id":"proteintech-30291-1-ap","title":"Proteintech, 30291-1-AP, VAV3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAV3 (30291-1-AP) by Proteintech is a Polyclonal antibody targeting VAV3 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n30291-1-AP targets VAV3 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, THP-1 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissue, human kidney tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells, HeLa cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVav3, a member of Dbl family which is also the activator of GTP kinase of Rho family, can activate the expression of RhoA, Racl and Cdc42 (PMID:28285969). Vav3 is associated with tumor growth, apoptosis, invasion, metastasis and angiogenesis (PMID:28285969). Vav3 is a multiple function protein with both signaling molecule and coactivator activities. Vav3 oncogene is overexpressed in androgen-independent prostate cancer cells relative to their androgen-dependent counterparts and contribute to development of hormone refractory prostate cancer (PMID:21455584).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33022 Product name: Recombinant human VAV3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 546-847 aa of NM_006113 Sequence: KCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE Predict reactive species\nFull Name: vav 3 guanine nucleotide exchange factor\nCalculated Molecular Weight: 98kd\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: NM_006113\nGene Symbol: VAV3\nGene ID (NCBI): 10451\nRRID: AB_3086288\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKW4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869626781865,"sku":"30291-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30291-1-ap","provider":"Iright","version":"1.0","type":"link"}