{"product_id":"proteintech-30302-1-ap","title":"Proteintech, 30302-1-AP, OGG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OGG1 (30302-1-AP) by Proteintech is a Polyclonal antibody targeting OGG1 in WB, ELISA applications with reactivity to human, rat samples\n30302-1-AP targets OGG1 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe DNA damages induced by ROS contain base modification, base loss, and DNA single strand breaks, which are usually repaired by the base excision repair (BER) pathway in both prokaryotes and eukaryotes. OGG1 (The human 8-oxoguanine glycosylase 1) is the primary enzyme in BER pathway, responsible for the excision of 7, 8-dihydro-8-oxoguanine (8-oxoG), a mutagenic base byproduct that occurs as a result of exposure to reactive oxygen species. There's 8 isoforms of OGG1, with calculated MW 22 kDa, 36-40 kDa and 45-57 kDa. The difference among these isoforms is the C-terminal (317-345aa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32962 Product name: Recombinant human OGG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC000657 Sequence: MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYF Predict reactive species\nFull Name: 8-oxoguanine DNA glycosylase\nCalculated Molecular Weight: 22 kDa, 36-40 kDa, 45-57 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC000657\nGene Symbol: OGG1\nGene ID (NCBI): 4968\nRRID: AB_2935539\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15527\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868829896873,"sku":"30302-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30302-1-ap","provider":"Iright","version":"1.0","type":"link"}