{"product_id":"proteintech-30326-1-ap","title":"Proteintech, 30326-1-AP, PFKM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PFKM (30326-1-AP) by Proteintech is a Polyclonal antibody targeting PFKM in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n30326-1-AP targets PFKM in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, HEK-293 cells,  Raji cells,  MCF-7 cells\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: 48-well HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPFKM, also named as GSD7, PFK-1, PFK-M and PFKX, belongs to the phosphofructokinase family and two domains subfamily. PFKM catalyzes the reaction: ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. It is a key regulatory enzyme in glycolysis. Defects in PFKM are the cause of glycogen storage disease type 7 (GSD7). PFKM has three isoforms with molecular masses of 85, 82 and 93 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag30840 Product name: Recombinant human PFKM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 675-725 aa of BC021203 Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE Predict reactive species\nFull Name: phosphofructokinase, muscle\nObserved Molecular Weight: 75-85 kDa\nGenBank Accession Number: BC021203\nGene Symbol: PFKM\nGene ID (NCBI): 5213\nRRID: AB_3086294\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08237\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869727248553,"sku":"30326-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30326-1-ap","provider":"Iright","version":"1.0","type":"link"}