{"product_id":"proteintech-30383-1-ap","title":"Proteintech, 30383-1-AP, Antizyme inhibitor 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Antizyme inhibitor 1 (30383-1-AP) by Proteintech is a Polyclonal antibody targeting Antizyme inhibitor 1 in WB, ELISA applications with reactivity to human samples\n30383-1-AP targets Antizyme inhibitor 1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAZIN1(Antizyme inhibitor 1) is also named as OAZI, OAZIN and belongs to the Orn\/Lys\/Arg decarboxylase class-II family. It catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis, and playing a role in the regulation of polyamine synthesis (negative regulator of cellular polyamines).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33058 Product name: Recombinant human AZIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 124-213 aa of BC019279 Sequence: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYVHALS Predict reactive species\nFull Name: antizyme inhibitor 1\nCalculated Molecular Weight: 49.5 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC019279\nGene Symbol: AZIN1\nGene ID (NCBI): 51582\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14977\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868829700265,"sku":"30383-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30383-1-ap","provider":"Iright","version":"1.0","type":"link"}