{"product_id":"proteintech-30428-1-ap","title":"Proteintech, 30428-1-AP, CTCF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CTCF (30428-1-AP) by Proteintech is a Polyclonal antibody targeting CTCF in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to Human, mouse samples\n30428-1-AP targets CTCF in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  RAW 264.7 cells\nPositive IP detected in: MCF-7 cells\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranscriptional insulators are DNA elements that set boundaries on the actions of enhancer and silencer elements and thereby organize the eukaryotic genome into regulatory domains. All vertebrate insulators appear to use the versatile CTCF protein. CTCF uses various combinations of its 11 zinc fingers to recognize a variety of unrelated DNA sequences. Once bound to DNA, CTCF can function as a transcriptional insulator, repressor, or activator, depending on the context of the binding site [PMID:12787766,15454938]. In vertebrates, this 11 zinc-finger protein is shown to be crucial in processes of epigenetic imprinting, X chromosome inactivation , and associated with various complex human diseases including cancer and diabetes [PMID:23139640]. The calcualted molecular weight of CTCF is 83 kDa, but stimulation of human corneal epithelial cells with hypoxic stress suppressed a high molecular mass form of CTCF (150 kDa), but not a lower molecular weight form of CTCF (130 kDa)(PMID: 22354964), and there are multiple isoforms of CTCF with molecular masses of 55, 70, 73, 80, 97, and 130 kDa have been observed (PMID: 12878173).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag32417 Product name: Recombinant human CTCF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 562-727 aa of BC014267 Sequence: KTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKRKMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR Predict reactive species\nFull Name: CCCTC-binding factor (zinc finger protein)\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 110-150 kDa\nGenBank Accession Number: BC014267\nGene Symbol: CTCF\nGene ID (NCBI): 10664\nRRID: AB_3086312\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49711\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869664792745,"sku":"30428-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30428-1-ap","provider":"Iright","version":"1.0","type":"link"}