{"product_id":"proteintech-30469-1-ap","title":"Proteintech, 30469-1-AP, GSDMC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSDMC (30469-1-AP) by Proteintech is a Polyclonal antibody targeting GSDMC in WB, IHC, ELISA applications with reactivity to human samples\n30469-1-AP targets GSDMC in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, HCT 116 cells,  A375 cells\nPositive IHC detected in: Human bowens diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGasdermin (GSDM) superfamily consists of Gasdermin family genes (GSDMA, GSDMB, GSDMC and GSDMD in humans) and Gasdermin-related genes (DFNA5, DFNB59 in humans). GSDM family members were shown to be detected in the epithelium of various tissue types in a highly tissue-specific manner and suggested to have differentiation-status specific roles. Gasdermin C (GSDMC) was known as melanoma-derived leucine zipper-containing extranuclear factor (MLZE). Several studies have suggested that GSDMC may be involved in the course of tumorigenesis such as acquisition of metastatic potential in melanoma cells or promotion of cell proliferation in colorectal carcinogenesis and that GSDMC may function as an oncogene. (PMID: 29428815)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33319 Product name: Recombinant human GSDMC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-508 aa of NM_031415 Sequence: VHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA Predict reactive species\nFull Name: gasdermin C\nCalculated Molecular Weight: 58kd\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: NM_031415\nGene Symbol: GSDMC\nGene ID (NCBI): 56169\nRRID: AB_3086329\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BYG8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869409792169,"sku":"30469-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30469-1-ap","provider":"Iright","version":"1.0","type":"link"}