{"product_id":"proteintech-30486-1-ap","title":"Proteintech, 30486-1-AP, PLK3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLK3 (30486-1-AP) by Proteintech is a Polyclonal antibody targeting PLK3 in WB, IHC, IP, ELISA applications with reactivity to human samples\n30486-1-AP targets PLK3 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, K-562 cells,  NCI-H1299 cells,  U2OS cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLK3(Polo-like kinase 3) is also named as CNK, FNK, PRK and belongs to the protein kinase superfamily. It is involved in the regulation of DNA damage checkpoint as well as in M-phase function. Plk3 physically interacts with p53 and phosphorylates this tumor suppressor protein on serine-20, suggesting that the role of Plk3 in cell cycle progression is mediated, at least in part, through direct regulation of p53(PMID:12548019).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33186 Product name: Recombinant human PLK3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 550-646 aa of BC013899 Sequence: PSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA Predict reactive species\nFull Name: polo-like kinase 3 (Drosophila)\nCalculated Molecular Weight: 72 kDa\nObserved Molecular Weight: 72 kDa\nGenBank Accession Number: BC013899\nGene Symbol: PLK3\nGene ID (NCBI): 1263\nRRID: AB_3669726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H4B4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817543337,"sku":"30486-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-30486-1-ap","provider":"Iright","version":"1.0","type":"link"}